PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G11480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 281aa    MW: 31076.4 Da    PI: 6.1812
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G11480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-162067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd  l+  v+ +G g+W+ +ar  g++Rt+k+c++rw++yl
  LPERR01G11480.1 20 RGPWTVEEDAVLAGHVAAHGEGRWNEVARAAGLRRTGKSCRLRWLNYL 67
                     89********************************************97 PP

2Myb_DNA-binding53.36.2e-1773116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E++l+++++ ++G++ W++Ia++m+ gRt++++k++w++
  LPERR01G11480.1  73 RGDFSPQEQLLILELHFRWGNR-WSKIAQHMP-GRTDNEIKNYWRT 116
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-221470IPR009057Homeodomain-like
PROSITE profilePS5129423.0681571IPR017930Myb domain
SuperFamilySSF466891.8E-3018114IPR009057Homeodomain-like
SMARTSM007175.1E-131969IPR001005SANT/Myb domain
PfamPF002498.8E-152067IPR001005SANT/Myb domain
CDDcd001673.44E-92267No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2371121IPR009057Homeodomain-like
PROSITE profilePS5129417.77872122IPR017930Myb domain
SMARTSM007176.3E-1572120IPR001005SANT/Myb domain
PfamPF002495.0E-1673116IPR001005SANT/Myb domain
CDDcd001676.79E-1176116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDLSCGWNSA AAADQEEIRR GPWTVEEDAV LAGHVAAHGE GRWNEVARAA GLRRTGKSCR  60
LRWLNYLRPD VRRGDFSPQE QLLILELHFR WGNRWSKIAQ HMPGRTDNEI KNYWRTRVQK  120
HAKQLGVDVA SARFRDVMRH LWMPRLVERI HAAAAAAAAT TTEHATPVDV CHSPDPSTTT  180
SCTAGTSSST STSMSVPHNH HLTAMTTSVA EAAADWSGSE QCGSASGGIS DDMFEGSWSE  240
LLARAYGDDG ADSSLLPDMH MAAETGEGWW SFEDIWSQQQ Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241712024126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2416151e-173AK241615.1 Oryza sativa Japonica Group cDNA, clone: J065186D02, full insert sequence.
GenBankAP0028831e-173AP002883.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0487H02.
GenBankAP0031401e-173AP003140.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0025P13.
GenBankAP0149571e-173AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630818.11e-137PREDICTED: transcription factor MYB108
TrEMBLA0A0D9V0100.0A0A0D9V010_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g19330.11e-136(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.16e-77myb domain protein 112